Table 2.

Expressed mouse and human H chain names and CDRs protein sequences

NameVH/DH/JHCDR1CDR2CDR3
Mouse anti-DNA H chains
3H9VMU-3.2/DSP2.13/JH3SSWMNRIYPRDGDINYNGKFKDARSKYSYVMDY
56RVMU-3.2/DSP2.13/JH3SSWMNRIYPRDGRINYNGKFKDARSKYSYVMDY
Human H chains
OK57IGHV3-30-3/IGHD5-5(18)/IGHJ4SYAMHVISYDGSNKYYADSVKGSKLRRTGALCGY
OK13IGHV4-34IGHD/D5-5/IGHJH3GYYWSEINHSGS-TNYNPSLKSRRARGYSYGDRLANDAFDI
KS60IGHV3-21/IGHD3-22/IGHJ3SYSMNSISSSSSYIYYADSVKGAFDYDRRVRRGLDAFDI
OK7IGHV3-21/IGHD3-22/IGHJ1SYSMNSISSSSSYIYYADSVKGRADYYDSSGYHEYFQH