|
||
ARTICLE |
CORRESPONDENCE Mathias Hornef: hornef.mathias{at}mh-hannover.de
|
|
|---|
The innate immune system provides efficient protection from microbial infection of vulnerable body surfaces through the expression of small cationic peptide antibiotics named antimicrobial peptides. In the small intestine, they are produced in large quantities by Paneth cells situated at the lower end of intestinal crypts (1). The importance of Paneth cell–derived antimicrobial peptides for antibacterial protection and the maintenance of intestinal homeostasis has been previously demonstrated (2, 3). Metalloproteinase (MMP)-7–deficient mice, which are unable to activate antimicrobial peptides via proteolytic cleavage, show enhanced susceptibility to Salmonella infection (2). Also, transgenic mice expressing human
-defensin 5 in Paneth cells show enhanced resistance against bacterial challenge (3). Finally, impaired synthesis of antimicrobial peptides has recently been shown in patients with inflammatory bowel disease, and a causal link has been proposed (4). Significant physiological and anatomical changes are observed in the gastrointestinal tract during the postnatal period. Although neonates are fed solely with maternal milk, they soon start to ingest additional nutrients and finally rely on solid food. These changes induce a significant increase and diversification of the bacterial microflora within the intestinal tract (5). Also, the spectrum of pathogens that gain entrance via the oral route is markedly altered. Exposure to important neonate pathogens such as Streptococcus agalactiae (group B streptococci [GBS]), Escherichia coli K1, or Listeria monocytogenes is largely limited to the intense contact with the mother's intestinal or vaginal microflora during the passage through the birth canal (6). These pathogens are taken up through the oral route, gain entrance through gastrointestinal mucosal membranes, and potentially lead to systemic disease during the postnatal period.
In mice, Paneth cells and significant expression of enteric antimicrobial peptides appear only
2 wk after birth accompanying the development of intestinal crypts (7–9). However, the innate host defense effector molecules that protect the neonate intestine in the absence of Paneth cells and Paneth cell–derived antimicrobial peptides are ill defined. In this paper, we describe a systematic analysis of the expression of antimicrobial peptides by intestinal epithelial cells (IECs) during the postnatal period. We confirm absent or marginal synthesis of known enteric antimicrobial peptides during the postnatal period. Strikingly, we demonstrate strong expression of the cathelicidin cathelin-related antimicrobial peptide (CRAMP) in IECs and restriction of CRAMP production to the neonatal period. Thus, this study for the first time describes a complete developmental switch in the expression of antimicrobial peptides and their anatomical distribution. Our findings highlight the variability of the innate immune defense mechanisms to combat the changing microbial challenge encountered by the developing organism.
| RESULTS |
|---|
|
|
|---|
|
|
Detection of the cathelicidin CRAMP in neonate intestinal tissue
To identify protective antibacterial molecules in mouse neonate intestine, gene expression analysis for the mouse Cramp was included. Strikingly, significant expression of Cramp in primary IECs was found during the early postnatal developmental stages but completely disappeared between days 14 and 21, concomitant with the appearance of Paneth cell–derived peptides (Fig. 3 A).
Similar results were obtained using a commercial hybridization probe–based assay for quantitative determination of Cramp mRNA (not depicted). Also, primary IECs isolated from older healthy individuals did not reveal any detectable constitutive Cramp expression (Fig. S1A, available at http://www.jem.org/cgi/content/full/jem.20071022/DC1). Immunoblotting of neonate (day 3) and adult (day 28) IECs confirmed the restriction of CRAMP expression to newborn epithelium and revealed the presence of the processed mature form of CRAMP in neonate IECs (Fig. 3 B, left). Although the cathelin propeptide was exclusively found in cell lysate, the processed mature form was additionally seen in cell supernatant, suggesting intracellular cleavage before secretion of the biologically active peptide by IECs (Fig. 3 B, right). Restriction of CRAMP expression to the neonate period was also noted by immunostaining of intestinal tissue of 3-, 6-, 14-, 21-, and 28-d-old mice (Fig. 3 C). Enzymatic processing could be performed by pancreatic elastase or proteinase 3, both of which are expressed in primary neonatal intestinal epithelium (Fig. 3 D). Alternatively, trypsin activity has recently been identified in mouse small intestinal tissue (13). Thus, constitutive expression and production of the processed mature form of CRAMP was detected in small intestinal epithelium restricted to the neonatal period.
|
-defensins, CRS peptides, or angiogenin 4, were detectable by RT-PCR (Fig. 4 A) or mass spectrometry (not depicted), the synthesis of CRAMP was confirmed by FACS analysis and immunohistology (Fig. 4, B and C).
Evaluation of m-ICcl2 cells cultured under differentiating and polarizing conditions revealed a significant and inducible antibacterial activity in cell lysate and culture supernatant (Fig. 4, D and E). In addition, m-ICcl2 cells express pancreatic elastase and proteinase 3 (not depicted) and, thus, confirm the phenotype observed in primary neonate IECs isolated from newborn mice.
|
|
Strikingly, careful analysis of epithelial CRAMP expression during the third week after birth suggested that disappearance of CRAMP after the postnatal period was not caused by down-regulation of transcriptional activity but rather occurred in an anatomically compartmentalized fashion. Reduced expression was first noticed at the level of the crypts and lower villi and reached the tip of the villi some days later (Fig. 5 D). Loss of CRAMP expression was accompanied by an increase of epithelial cell proliferation and the formation of intestinal crypts (Fig. 5 E and Fig. 2C). These data are in accordance with a recent report on low Wnt signaling activity in the intervillus region directly after birth and increased activity in the crypt area of adult individuals (18). They further suggest that CRAMP expression is limited to the neonate epithelium and lost during the developmental changes that occur in the postnatal period associated with increased IEC proliferation and differentiation.
CRAMP-mediated antibacterial activity against commensal and pathogenic enteric bacteria
To establish a possible role in enteric host protection, we next tested the CRAMP-mediated antibacterial activity against gut commensal bacteria, as well as defined pathogenic bacteria known to be transmitted to the neonate organism during passage through the birth canal (6). Rapid bacterial killing resulting in a 3–4 log decrease of viable bacteria after 2 h was noted against selected Gram-positive and -negative intestinal commensal bacteria of the small intestine such as S. gallinaceus, Lactobacillus murinus, L. reuteri, and the nonpathogenic E. coli strain D21 at peptide concentrations between 10 and 50 µg/ml (Fig. 6 A).
Similarly, perinatally transmitted pathogens associated with systemic disease in neonates such as S. agalactiae (GBS), capsule-positive E. coli K1, or Salmonella enterica serovar Typhimurium (S. Typhimurium) were susceptible toward the bacterial killing activity of CRAMP (Fig. 6 B).L. monocytogenes, a major cause of neonatal meningitis after oral ingestion during birth (described as late onset disease in contrast to the early onset disease after transplacental transmission) demonstrated particular susceptibility, with 99% killing within 2 h by <1 µg/ml CRAMP (Fig. 6 B).
|
| DISCUSSION |
|---|
|
|
|---|
Cathelicidins are released by proteolytic cleavage from their precursor molecules. Expression of the precursor peptide has been noted in myeloid cells, keratinocytes, and epithelial cells from the skin, lung, stomach, colon, meninges, and eye, as well as endothelial cells (25–28). Although they represent a large and important group of antimicrobial peptides in a variety of mammals, only one member, LL-37 and CRAMP, is encoded in humans and mice, respectively. Significant cathelicidin expression has previously been noted in the gastrointestinal tract, such as human gastric or colonic tissue, with higher expression levels in individuals with persistent bacterial infection or chronic inflammation (27, 29). Although our results obtained using highly purified primary IECs indicated the absence of constitutive Cramp expression in adult individuals, Cramp mRNA was recently noted in total adult small intestinal tissue (30). The different results might reflect expression by resident tissue myeloid cells. However, we cannot rule out the reappearance of small intestinal epithelial Cramp expression in adult individuals during conditions such as tumorigenesis or inflammatory processes.
Importantly, lack of cathelicidin synthesis was associated with clinical disease, such as periodontitis, in human individuals with congenital neutropenia (Kostmann syndrome) and enhanced susceptibility to recurrent urinary tract infection (26, 31). CRAMP expression also conferred protection from invasive skin infection by group A streptococci and Citrobacter rodentium–induced colitis in mice (25, 32). The clinical importance of CRAMP was further underlined by the description of mechanisms to gain resistance against peptide-mediated killing by several human pathogenic bacteria (33, 34). In addition to the broad and potent antibacterial activity, cathelicidin-derived antimicrobial peptides have also been noted to exert other biological activities so as to promote cell differentiation and to stimulate angiogenesis and epithelial cell proliferation (15, 16). Although our results do not support an involvement of epithelial CRAMP in the postnatal intestinal organ development, other CRAMP-mediated biological effects on neonate gut homeostasis cannot be excluded.
The finding that germ-free mice, similar to conventionally bred mice, completely lost intestinal epithelial CRAMP expression precludes an active role of the enteric microflora in the down-regulation of intestinal CRAMP expression. Similar results have been found for cryptdin expression in Paneth cells (11). The close temporal association between the loss of CRAMP expression and developmental changes such as the increase of epithelial proliferation, the emergence of crypts, and the appearance of mature Paneth cells instead indicate a developmentally controlled process. Indeed, cathelicidin expression has previously been linked to cell differentiation and exposure to differentiation-promoting agents (35, 36). Developmental regulation is also supported by the recently identified differential expression profile of the Wnt transcriptional effectors Tcf3 and Tcf4 during the development of the mouse intestinal epithelium (18). The identified increase in epithelial proliferation during the postnatal development is paralleled by enhanced Wnt signaling in the area of cellular proliferation (18). The restriction of CRAMP expression to neonate epithelium and the gradual loss of CRAMP-positive cells along the crypt–villus axis might therefore result from a combined developmental program of cell differentiation and proliferation.
In conclusion, we describe a complete change of the antimicrobial peptide repertoire in the intestinal epithelium during the postnatal period. This switch of the antimicrobial peptide expression highlights the variability of the innate host defense system to encounter the changing spectrum of microbial challenge. Neonate enteric CRAMP expression might provide protection from pathogens and contribute to the establishment of a stable host–microbe homeostasis. The establishment of the physiological microflora in combination with an increase in epithelial cell turnover in adult individuals might later facilitate restriction of antimicrobial peptide production to Paneth cells at the bottom of intestinal crypts to form a more dynamic barrier that is efficient against bacterial pathogens but allows the existence of a bacterial microflora.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Quantitative real-time PCR analysis.
Total RNA was obtained using TRIZOL reagent (Invitrogen) according to the manufacturer's protocol. Complementary DNA (cDNA) was synthesized from 1 µg of total mRNA using oligo(dT)18 primer from the first-strand cDNA synthesis AMV kit (Roche). The following primers were used for cDNA amplification: Angiogenin 1 (forward, 5'-AGGCCCGTTGTTCTTGATCT-3'; reverse, 5'-TGAGGTTAGGCTTCTTCTCTTCA-3'), Angiogenin 4 (forward, 5'-GACAATGAGCCCATGTCCTT-3'; reverse, 5'-TTTGGCTTGGCATCATAGTG-3'), Cramp (forward, 5'-CCGAGCTGTGGATGACTTCAAML-3'; reverse,5'-CTGCCCCCATACACTGCTTCAC-3'), Crs1-C (forward, 5'-GTCTCCTTTGGAGGCACAGA-3'; reverse, 5'-GCTTGGGTGGTGATAGCAGT-3'), E-cadherin (forward, 5'-GGCTTCAGTTCCGAGGTCTA-3';reverse, 5'-CGAAAAGAAGGCTGTCCTTG-3'), Elastase (forward, 5'-TGTGGACACAGTACCGAGGA -3'; reverse, 5'-GGTCATCACCCAGTTGCTTC-3'), Kallikrein 5 (forward, 5'-CAATGGCTACCCTGATCACA-3'; reverse, 5'-GTCCTCCCCAGACTTGGAAT-3'), Kallikrein 7(forward, 5'-CAGGGAGTGCAAGAAGGTGT-3'; reverse, 5'-TAGGTACCCCAGGACACCAG-3'), Mmp-7 (forward, 5'-TTTGATGGGCCAGGGAACACTCTA-3'; reverse, 5'-ATGGGTGGCAGCAAACAGGAAGT-3'),Occludin (forward, 5'-AGCGCTATCCTGGGCATCAT-3'; reverse, 5'-ATCCATCTTTCTTCGGGTTTTCAC-3'), Proteinase 3 (forward, 5'-ACGGTGGTCACCTTCCTATG-3'; reverse, 5'-GCGAAGAAATCAGGGAACTG-3'), and Zo-1 (forward, 5'-TCTGAGGGGAAGGCGGATGGTGCT-3'; reverse, 5'-TTGTGGCTGCGCTTGTGGTGAGTAA-3'). The primers for Cryptin 1 (forward [Defcrp130], 5'-AAGAGACTAAAACTGAGGAGCAGC-3'; reverse, 5'-CGCAGCAGAGCGTGTA-3'), Cryptin 4(forward [Defcrp130], 5'-AAGAGACTAAAACTGAGGAGCAGC-3'; reverse, 5'-CGGCGGGGGCAGCAGTA-3'), and Cryptin 5 (forward [Defcrp130], 5'-AAGAGACTAAAACTGAGGAGCAGC-3'; reverse, 5'-GCAGCAGAATACGAAAGT-3') were as previously described (9). Hprt1 (forward, 5'-TGATCAGTCAACGGGGGACA-3'; reverse, 5'-TTCGAGAGGTCCTTTTCACCA-3') and β2-microglobulin (b2M; forward, 5'-TGGTGCTTGTCTCACTGAML-3'; reverse, 5'-CCGTTCTTCAGCATTTGGAT-3') were used as endogenous controls to normalize gene expression levels. Normalization to both Hprt1 and b2M revealed very similar results; the data shown in the figures were obtained after normalization to Hprt1. All primers used in this study—except for Angiogenin 1 and 4, as well as Mbd 1, 2, 4, and 14—were intron spanning, as demonstrated by the absence of amplification from genomic DNA. Non–intron-spanning PCR amplification was preceded by an RQ1 RNase-free DNase (Promega) digestion step, including the appropriate controls. SYBR green–based real-time PCRs for cDNA quantification were performed in 20-µl volumes by using both standard curves and the comparative CT method on a LightCycler instrument (Roche) and a sequence detector (ABI Prism 7900; Applied Biosystems).
Additionally, the comparative CT method was used to confirm alterations in Cramp gene expression by using Quantitect assays QT01195922 (Cramp) and QT00166768 (Hprt1; both from QIAGEN) and, additionally, by using TaqMan gene expression assays Mm00438285_m1 (Cramp) and Mm00446968_m1 (Hprt1; both from Applied Biosystems), according to the manufacturers' instructions. Quantitect assays were run on the LightCycler instrument, and Taqman assays were performed with the ABI Prism 7900 sequence detector. Quantitative analysis was performed according to the manufacturer's manuals and tutorials (available at http://www.appliedbiosystems.com). All PCRs were run in triplicate.
HPLC fractionation and mass spectrometric analysis.
Cationic antimicrobial peptides were extracted from isolated IECs of newborn and adult C57BL/6 mice or m-ICcl2 cell lysate, according to a published protocol (12). The antibacterial activity of HPLC fractions was analyzed using a zone inhibition assay using B. megaterium strain 11 (11). Cell-culture supernatant was purified using Sep-Pak Light tC18 cartridges (Waters Corp.) before antibacterial testing and mass spectrometric analysis. Matrix-assisted laser desorption-ionization time-of-flight mass spectrometry analysis was performed with a Reflex III instrument (Bruker Daltronics), as recently described (11).
Immunohistology, flow cytometry, and immunoblotting.
Immunostaining was performed on small intestines from newborn and 1-, 3-, 6-, 14-, 16-, 18-, 21-, and 28-d-old mice. Paraformaldehyde-fixed slides were deparaffinized and heated at 120°C for 3 min in 10 mM Na-citrate, pH 6, to improve antigen accessibility. Rabbit antilysozyme antiserum (1:250; Dako), anti–cryptdin 2 (1:1,000), or anti-Ki67 protein antiserum (1:2,000; provided by T. Scholzen, Research Center Borstel, Borstel, Germany) was incubated for 1 h at room temperature and detected using a Texas red–conjugated anti–rabbit secondary antibody (1:50; Jackson ImmunoResearch Laboratories). Cryosections were acetone fixed and incubated with rabbit anti-CRAMP antiserum at a final dilution of 1:500 for 90 min at room temperature. Primary antibody detection was performed with a goat anti–rabbit Cy3-conjugated secondary antibody (Jackson ImmunoResearch Laboratories). Counterstaining was performed with MFP488 phalloidin (MoBiTec) or fluorescein-conjugated wheat germ agglutinin at a dilution of 1:50 (Vector Laboratories), as indicated in the figures. Slides were mounted in DAPI containing Vectashield (Vector Laboratories) and visualized using an ApoTome-equipped microscope (Axioplan 2) connected to a digital camera (AxioCam Mr; all purchased from Carl Zeiss, Inc.). CRAMP expression was visualized by flow cytometry after fixation (Cytofix; BD Biosciences), with permeabilization in Ca2+- and Mg2+-free PBS containing 0.5% saponin and 2% FCS using a rabbit anti-CRAMP antiserum (1:500) or control serum in combination with a TR-conjugated anti–rabbit secondary antibody. Cells were analyzed on a FACSCalibur apparatus (BD Biosciences). Immunoblotting was performed as recently described (10). Membranes were incubated overnight at 4°C, with the primary antibody provided by B. Agarberth (Karolinska Institute, Stockholm, Sweden) at a 1:1,000 dilution. Detection was performed using peroxidase-conjugated goat anti–rabbit secondary antibody (Jackson ImmunoResearch Laboratories) in combination with the ECL kit (GE Healthcare). To confirm equal loading, actin staining was used with a rabbit polyclonal actin antiserum (Sigma-Aldrich).
Determination of CRAMP antibacterial activity and bacterial challenge.
Mature CRAMP peptide ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE was synthesized with a purity of >95% (Innovagen) and tested by HPLC and mass spectrometry. L. murinus, L. reuteri, and S. gallinaceus were mouse small intestinal isolates identified biochemically and confirmed by 16S ribosomal RNA gene sequencing. S. Typhimurium 14028 was received from the American Type Culture Collection, and the nonpathogenic E. coli strain D21 and the clinical isolate L. monocytogenes type 1 were received from the laboratory strain collection. Encapsulated E. coli K1 and S. agalactiae (GBS) were human clinical isolates provided by R. Berner (University of Freiburg, Freiburg, Germany). The antibacterial activity of peptides was evaluated with a broth microdilution assay in 10 mM sodium phosphate buffer supplemented with 1% tryptic soy broth supplemented with 0.5% yeast extract (TSB-Y; Difco) for L. monocytogenes, E. coli K1, S. gallinaceus, and S. agalactiae. Sodium phosphate buffer was supplemented with 1% MRS broth for lactobacilli species and with 1% Luria-Bertani broth for E. coli D21 and S. Typhimurium, as previously described (37). 104 bacteria grown to mid-logarithmic phase were coincubated in 100 µl with or without the addition of peptide at the concentrations indicated in the figures (0.5, 1, 5, 10, 20, and 50 µg/ml). The number of viable bacteria (CFU) was analyzed after 2 h by serial dilution. Cramp-deficient (Cramp–/–) as well as Cramp+/+ 129/SvJ mice were bred at the Animal Facility of the Microbiology and Tumor Biology Center (Karolinska Institutet). For in vivo analysis, 5-d-old Cramp+/+ and Cramp–/– mice were orally infected with 106 CFU L. monocytogenes in 5 µl of bicarbonate buffer. 24 h after infection, mice were killed and the small intestine was removed and homogenized. The number of viable bacteria per gram of tissue was determined by serial dilution. All in vivo experiments were conducted in agreement with European Communities Council Directive 86/609/EEC and Swedish animal protection legislation.
Statistical analysis.
Results are given as the mean ± SD or median ± interquartile range, as indicated. Statistical analyses were performed using the Student's t test. P < 0.05 was considered significant.
Online supplemental material.
Fig. S1 A shows no detectable Cramp expression in primary IECs isolated from small intestinal tissue of 8- and 15-wk-old mice using quantitative mRNA analysis. The absence of an effect of CRAMP on epithelial cell proliferation and cell viability is demonstrated in Fig. S1 (B and C). Fig. S1 (D and E) illustrate the strong endotoxin-blocking activity of CRAMP on naive cells but the absence of a detectable effect of CRAMP on LPS-tolerized IECs. Online supplemental material is available at http://www.jem.org/cgi/content/full/jem.20071022/DC1.
| Acknowledgments |
|---|
This work has been supported by grants from the German Research Foundation (HO 2236/5), the Swedish Research Council (K2003-31P-14792 to M.W. Hornef, K2005-06X-15405 to M. Aandersson, and K2003-06XD-14653 to K. Putsep), the Swedish Cancer Foundation (Cancerfonden), the Thyssen Foundation (AZ 10.05.2.173), the University of Freiburg (M.W. Hornef), the Swedish Foundation for International Cooperation in Research and Higher Education (M. Andersson), the Ruth and Richard Juhlin's Foundation (K. Putsep), and the Fondation de la Recherche Médical (S. Ménard).
The authors have no conflicting financial interests.
Submitted: 22 May 2007
Accepted: 4 December 2007
S. Ménard's present adresses is Institut National de la Santé et de la Recherche Médicale, U793, Faculté Necker-Enfants-Malades, 75730 Paris, Cedex 15, France.
E. Glocker's present address is Royal Free and University College Medical School, London WC1E 6BT, England, UK.
| REFERENCES |
|---|
|
|
|---|
1 Bevins, C.L. 2004. The Paneth cell and the innate immune response. Curr. Opin. Gastroenterol. 20:572–580.[CrossRef][Medline]
2 Wilson, C.L., A.J. Ouellette, D.P. Satchell, T. Ayabe, Y.S. Lopez-Boado, J.L. Stratman, S.J. Hultgren, L.M. Matrisian, and W.C. Parks. 1999. Regulation of intestinal alpha-defensin activation by the metalloproteinase matrilysin in innate host defense. Science. 286:113–117.
3 Salzman, N.H., D. Ghosh, K.M. Huttner, Y. Paterson, and C.L. Bevins. 2003. Protection against enteric salmonellosis in transgenic mice expressing a human intestinal defensin. Nature. 422:522–526.[CrossRef][Medline]
4 Wehkamp, J., N.H. Salzman, E. Porter, S. Nuding, M. Weichenthal, R.E. Petras, B. Shen, E. Schaeffeler, M. Schwab, R. Linzmeier, et al. 2005. Reduced Paneth cell alpha-defensins in ileal Crohn's disease. Proc. Natl. Acad. Sci. USA. 102:18129–18134.
5 Edwards, C.A., and A.M. Parrett. 2002. Intestinal flora during the first months of life: new perspectives. Br. J. Nutr. 88(Suppl. 1):S11–S18.[Medline]
6 Goldenberg, R.L., and C. Thompson. 2003. The infectious origins of stillbirth. Am. J. Obstet. Gynecol. 189:861–873.[CrossRef][Medline]
7 van Es, J.H., P. Jay, A. Gregorieff, M.E. van Gijn, S. Jonkheer, P. Hatzis, A. Thiele, M. van den Born, H. Begthel, T. Brabletz, et al. 2005. Wnt signalling induces maturation of Paneth cells in intestinal crypts. Nat. Cell Biol. 7:381–386.[CrossRef][Medline]
8 Bry, L., P. Falk, K. Huttner, A. Ouellette, T. Midtvedt, and J.I. Gordon. 1994. Paneth cell differentiation in the developing intestine of normal and transgenic mice. Proc. Natl. Acad. Sci. USA. 91:10335–10339.
9 Darmoul, D., D. Brown, M.E. Selsted, and A.J. Ouellette. 1997. Cryptdin gene expression in developing mouse small intestine. Am. J. Physiol. 272:G197–G206.[Medline]
10 Lotz, M., D. Guetle, S. Walther, S. Menard, C. Bogdan, and M.W. Hornef. 2006. Postnatal acquisition of endotoxin tolerance in intestinal epithelial cells. J. Exp. Med. 203:973–984.
11 Putsep, K., L.G. Axelsson, A. Boman, T. Midtvedt, S. Normark, H.G. Boman, and M. Andersson. 2000. Germ-free and colonized mice generate the same products from enteric prodefensins. J. Biol. Chem. 275:40478–40482.
12 Hornef, M.W., K. Putsep, J. Karlsson, E. Refai, and M. Andersson. 2004. Increased diversity of intestinal antimicrobial peptides by covalent dimer formation. Nat. Immunol. 5:836–843.[CrossRef][Medline]
13 Koshikawa, N., S. Hasegawa, Y. Nagashima, K. Mitsuhashi, Y. Tsubota, S. Miyata, Y. Miyagi, H. Yasumitsu, and K. Miyazaki. 1998. Expression of trypsin by epithelial cells of various tissues, leukocytes, and neurons in human and mouse. Am. J. Pathol. 153:937–944.
14 Bens, M., A. Bogdanova, F. Cluzeaud, L. Miquerol, S. Kerneis, J.P. Kraehenbuhl, A. Kahn, E. Pringault, and A. Vandewalle. 1996. Transimmortalized mouse intestinal cells (m-ICc12) that maintain a crypt phenotype. Am. J. Physiol. 270:C1666–C1674.[Medline]
15 Heilborn, J.D., M.F. Nilsson, G. Kratz, G. Weber, O. Sørensen, N. Borregaard, and M. Ståhle-Bäckdahl. 2003. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. J. Invest. Dermatol. 120:379–389.[CrossRef][Medline]
16 Tokumaru, S., K. Sayama, Y. Shirakata, H. Komatsuzawa, K. Ouhara, Y. Hanakawa, Y. Yahata, X. Dai, M. Tohyama, H. Nagai, et al. 2005. Induction of keratinocyte migration via transactivation of the epidermal growth factor receptor by the antimicrobial peptide LL-37. J. Immunol. 175:4662–4668.
17 Mookherjee, N., K.L. Brown, D.M. Bowdish, S. Doria, R. Falsafi, K. Hokamp, F.M. Roche, R. Mu, G.H. Doho, J. Pistolic, et al. 2006. Modulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J. Immunol. 176:2455–2464.
18 Kim, B.M., J. Mao, M.M. Taketo, and R.A. Shivdasani. 2007. Phases of canonical Wnt signaling during the development of mouse intestinal epithelium. Gastroenterology. 133:529–538.[Medline]
19 Lecuit, M., S. Dramsi, C. Gottardi, M. Fedor-Chaiken, B. Gumbiner, and P. Cossart. 1999. A single amino acid in E-cadherin responsible for host specificity towards the human pathogen Listeria monocytogenes. EMBO J. 18:3956–3963.[CrossRef][Medline]
20 Lecuit, M., S. Vandormael-Pournin, J. Lefort, M. Huerre, P. Gounon, C. Dupuy, C. Babinet, and P. Cossart. 2001. A transgenic model for listeriosis: role of internalin in crossing the intestinal barrier. Science. 292:1722–1725.
21 Mallow, E.B., A. Harris, N. Salzman, J.P. Russell, R.J. DeBerardinis, E. Ruchelli, and C.L. Bevins. 1996. Human enteric defensins. Gene structure and developmental expression. J. Biol. Chem. 271:4038–4045.
22 Yoshio, H., H. Lagercrantz, G.H. Gudmundsson, and B. Agerberth. 2004. First line of defense in early human life. Semin. Perinatol. 28:304–311.[CrossRef][Medline]
23 Starner, T.D., B. Agerberth, G.H. Gudmundsson, and P.B. McCray Jr. 2005. Expression and activity of beta-defensins and LL-37 in the developing human lung. J. Immunol. 174:1608–1615.
24 Dorschner, R.A., K.H. Lin, M. Murakami, and R.L. Gallo. 2003. Neonatal skin in mice and humans expresses increased levels of antimicrobial peptides: innate immunity during development of the adaptive response. Pediatr. Res. 53:566–572.[CrossRef][Medline]
25 Nizet, V., T. Ohtake, X. Lauth, J. Trowbridge, J. Rudisill, R.A. Dorschner, V. Pestonjamasp, J. Piraino, K. Huttner, and R.L. Gallo. 2001. Innate antimicrobial peptide protects the skin from invasive bacterial infection. Nature. 414:454–457.[CrossRef][Medline]
26 Putsep, K., G. Carlsson, H.G. Boman, and M. Andersson. 2002. Deficiency of antibacterial peptides in patients with morbus Kostmann: an observation study. Lancet. 360:1144–1149.[CrossRef][Medline]
27 Hase, K., M. Muratami, M. Rimura, S.P. Cole, Y. Horibe, T. Ohtake, M. Obonyo, R.L. Gallo, L. Eckmann, and M.F. Kagnoff. 2003. Expression of LL-37 by human gastric epithelial cells as a potential host defense mechanism against Helicobacter pylori. Gastroenterology. 125:1613–1625.[CrossRef][Medline]
28 Schauber, J., C. Svanholm, S. Termen, K. Iffland, T. Menzel, W. Scheppach, R. Melcher, B. Agerberth, H. Luhrs, and G.H. Gudmundsson. 2003. Expression of the cathelicidin LL-37 is modulated by short chain fatty acids in colonocytes: relevance of signalling pathways. Gut. 52:735–741.
29 Schauber, J., D. Rieger, F. Weiler, J. Wehkamp, M. Eck, K. Fellermann, W. Scheppach, R.L. Gallo, and E.F. Stange. 2006. Heterogeneous expression of human cathelicidin hCAP18/LL-37 in inflammatory bowel disease. Eur. J. Gastroenterol. Hepatol. 18:615–621.[CrossRef][Medline]
30 Gallo, R.L., K.J. Kim, M. Bernfield, C.A. Kozak, M. Zanetti, L. Merluzzi, and R. Gennaro. 1997. Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse. J. Biol. Chem. 272:13088–13093.
31 Chromek, M., Z. Slamova, P. Bergman, L. Kovacs, L. Podracka, I. Ehren, T. Hokfelt, G.H. Gudmundsson, R.L. Gallo, B. Agerberth, and A. Brauner. 2006. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nat. Med. 12:636–641.[CrossRef][Medline]
32 Iimura, M., R.L. Gallo, K. Hase, Y. Miyamoto, L. Eckmann, and M.F. Kagnoff. 2005. Cathelicidin mediates innate intestinal defense against colonization with epithelial adherent bacterial pathogens. J. Immunol. 174:4901–4907.
33 Brodsky, I.E., N. Ghori, S. Falkow, and D. Monack. 2005. Mig-14 is an inner membrane-associated protein that promotes Salmonella typhimurium resistance to CRAMP, survival within activated macrophages and persistent infection. Mol. Microbiol. 55:954–972.[CrossRef][Medline]
34 Schmidtchen, A., I.M. Frick, E. Andersson, H. Tapper, and L. Bjorck. 2002. Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol. Microbiol. 46:157–168.[CrossRef][Medline]
35 Liu, P.T., S. Stenger, H. Li, L. Wenzel, B.H. Tan, S.R. Krutzik, M.T. Ochoa, J. Schauber, K. Wu, C. Meinken, et al. 2006. Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science. 311:1770–1773.
36 Raqib, R., P. Sarker, P. Bergman, G. Ara, M. Lindh, D.A. Sack, K.M. Nasirul Islam, G.H. Gudmundsson, J. Andersson, and B. Agerberth. 2006. Improved outcome in shigellosis associated with butyrate induction of an endogenous peptide antibiotic. Proc. Natl. Acad. Sci. USA. 103:9178–9183.
37 Hultmark, D., A. Engstrom, K. Andersson, H. Steiner, H. Bennich, and H.G. Boman. 1983. Insect immunity. Attacins, a family of antibacterial proteins from Hyalophora cecropia. EMBO J. 2:571–576.[Medline]
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TABLE OF CONTENTS |
|