The Journal of Experimental Medicine
for flow cytometry > invitrogen
  Home | Help | Feedback | Subscriptions | Archive | Search | Table of Contents

Published 20 May 2002. doi:10.1084/jem.20011876
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF, 148K)
Right arrow PPT slides of all figures
Right arrow Alert me when this article is cited
Right arrow Citation Map
Services
Right arrow Email this article
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new content in the JEM
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via CrossRef
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kariu, T.
Right arrow Articles by Chinzei, Y.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kariu, T.
Right arrow Articles by Chinzei, Y.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Facebook   Add to Reddit   Add to Technorati   Add to Twitter  
What's this?
© Rockefeller University Press, 0022-1007/2002/5/1317/ $5.00
The Journal of Experimental Medicine, Volume 195, Number 10, May 20, 2002 1317-1323

MAEBL Is Essential for Malarial Sporozoite Infection of the Mosquito Salivary Gland

Tohru Kariu, Masao Yuda, Kazuhiko Yano and Yasuo Chinzei

Department of Medical Zoology, Mie University School of Medicine, Edobashi, Tsu, 514-0001, Japan

Address correspondence to Masao Yuda, Department of Medical Zoology, Mie University School of Medicine, Edobashi, Tsu, 514-0001, Japan. Phone: 81-59-231-5013; Fax: 81-59-231-5215; E-mail: m-yuda{at}doc.medic.mie-u.ac.jp


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Malarial sporozoites mature in the oocysts formed in the mosquito midgut wall and then selectively invade the salivary glands, where they wait to be transmitted to the vertebrate host via mosquito bite. Invasion into the salivary gland has been thought to be mediated by specific ligand–receptor interactions, but the molecules involved in these interactions remain unknown. MAEBL is a single transmembrane-like protein that is structurally related to merozoite adhesive proteins. We found MAEBL of the rodent malaria parasite, Plasmodium berghei, to be specifically produced by the sporozoites in the oocyst and localized in their micronemes, which are secretory organelles involved in malarial parasite invasion into the host cell. A targeted disruption experiment of the P. berghei MAEBL gene revealed that it was essential for sporozoite infection of the salivary gland and was involved in the attachment to the salivary gland surface. In contrast, the disruption of the MAEBL gene did not affect sporozoite motility in vitro nor infectivity to the vertebrate host. These results suggest that P. berghei MAEBL is a sporozoite attachment protein that participates in specific binding to and infection of the mosquito salivary gland.

Key Words: parasitology • malaria • disease transmission • insect vectors • gene targeting


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Malaria remains one of the most devastating infectious diseases in the world. The development of effective strategies to limit its transmission is one of the most important objectives of malaria control programs. Therefore, an understanding of the biology of the malarial parasite in the mosquito vector is required. Transmission of the malarial parasite occurs when sporozoites are injected from the salivary gland into the host skin by bites from an infected mosquito. These malarial sporozoites are generated in oocysts formed on the mosquito midgut and released into the body cavity of the mosquito by oocyst rupture. They then selectively invade the salivary gland. There, they become infective to the vertebrate host and wait for the mosquito to bite (13). Because sporozoite infection of the mosquito salivary glands is a key step for malarial parasite transmission to the vertebrate host, efforts have been made to elucidate this mechanism. Some experiments suggest that sporozoite invasion into the salivary gland is mediated by specific ligand–receptor interactions (25). For instance, it was reported that antiserum against the salivary gland and lectins that recognize the salivary gland surface carbohydrates inhibited sporozoite invasion into the gland (5). However, the molecules mediating such specific interactions remain to be identified.

MAEBL genes were first identified in the rodent malaria parasites Plasmodium yoelii and Plasmodium berghei (Pb),*and seem to be highly conserved throughout the Plasmodium species including Plasmodium falciparum, a medically important human malarial parasite (6). MAEBL is an ~200-kD protein with a single transmembrane-like domain and is structurally related to members of the Plasmodium Duffy binding-like (DBL) family (78), which includes the Duffy antigen binding proteins of Plasmodium knowlesi and Plasmodium vivax (9), and the 175K erythrocyte binding antigen of P. falciparum (10). These proteins are produced in the merozoite stage, localized in micronemes, and believed to recognize host-specific erythrocyte surface receptors and participate in a junction formation necessary for merozoite entry into the host erythrocyte (11). MAEBL was reportedly produced in the merozoite stage (6) and based on structural similarities is classified as a member of a recently proposed expanded merozoite adhesive protein family, named the ebl family, which includes DBL family proteins and putative erythrocyte binding proteins encoded by newly identified P. falciparum genes, such as ebl-1, baebl, pebl, jesebl, and maebl (8). Among these members, MAEBL is exceptional in that its ligand binding domains are similar to those of apical membrane antigen 1 (12) rather than those of the DBL domain, as it was reported to be localized not in the microneme but in the rhoptry (13). Recently, Kappe et al. (14) reported that P. yoelii MAEBL is also produced in the sporozoite stage, which suggests its involvement in sporozoite infection.

In this paper, we report about the specific production of MAEBL by the sporozoites in the oocyst and its essential role in sporozoite infection of the salivary gland. The structural relation to the merozoite adhesive proteins, the subcellular localization, and the phenotype resulting from MAEBL gene disruption strongly suggests that MAEBL plays an essential role in the sporozoite as an attachment protein that is especially committed to the invasion of the salivary gland.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Parasite Preparations.
BALB/c mice infected with Pb ANKA strain were prepared by peritoneal injection of infected blood that was stored at -70°C. Infected mice were used within one blood passage for mosquito biting. For the purification of sporozoites, infected mosquitoes were anesthetized in CO2 20–24 d after the infective blood meal. Hemolymph was collected from a pinhole in the abdomen by the injection of 10 µl medium 199. The salivary glands and midgut were then dissected out, washed in saline, and separately collected in 70 µl medium 199 on ice. Collected tissues were gently ground in the medium to release sporozoites. After the removal of tissue fragments by centrifugation at 18 g for 3 min, sporozoites were collected from the supernatant by centrifugation at 5,000 g for 3 min.

For the purification of merozoites, infected rat blood was cultured for 16 h in medium RPMI 1640 (GIBCO BRL) containing 20% fetal calf serum, under 10% O2, and 5% CO2. Mature schizonts were purified from the cultured blood by density gradient using Nycoprep 1.077A (AXIS-SHIELD). For Western blot analysis, merozoites were additionally purified by erythrocyte lysis.

Assays for Sporozoite Gliding Motility and Infectivity to Rats.
Gliding motility and infectivity of sporozoites were assessed as described by Sultan et al. (15). For gliding motility assay, sporozoites were collected from the hemolymph of mosquitoes 24 d after an infective blood meal and kept for 2 h at 4°C in medium 199 containing 3% BSA. Gliding on an uncoated microscope slide was then observed under a phase-contrast microscope. For infectivity assay, sporozoites in the oocysts were collected from the mosquito midgut 24 d after an infective blood meal and intravenously injected into 3-wk-old Wistar rats. Their parasitemia was checked daily by a Giemsa-stained blood smear, and infection rates and the prepatent period of infection were determined.

Antibody Preparation and Western Blot Analysis.
For antibody preparation, the peptides ERKKAEAAKKAEEERKRIE and KLIGGRWFKEVAFDEIVEDYDKVYTLAMISNEQI, which correspond to the amino acid sequences of the repeat region and the COOH-terminal region of PbMAEBL, respectively, were synthesized. Each peptide was conjugated to keyhole limpet hemocyanin as a carrier and used for the immunization of rabbits. Specific antibodies were affinity purified from the antisera using a normal human serum–activated High Trap column (Amersham Pharmacia Biotech) linked with the respective peptides.

Western blot analysis was performed as previously described (16). In brief, purified parasites were homogenized in SDS-PAGE sample buffer containing 1% SDS and 5% 2-ME and boiled for 5 min. Parasite proteins (106 sporozoites or 3 x 106 merozoites per lane) were separated by SDS-PAGE on a 8% gel and electrophoretically transferred to a nitrocellulose membrane. The blotted membrane was blocked in PBS containing 5% skimmed milk, incubated for 60 min with primary antibodies diluted in the same buffer (20 µg/ml final concentration), washed, and then incubated for 60 min with alkaline phosphatase–conjugated anti–rabbit IgG (Bio-Rad Laboratories) diluted at 1:1,000 in the same buffer. After washing, signals were obtained using the AP Conjugate Substrate Kit (Bio-Rad Laboratories).

Immunofluorescence Microscopy.
Immunofluorescence microscopy was performed as previously described (16). In brief, purified parasites on glass slides were fixed in acetone for 2 min and rinsed in PBS. The slides were then blocked in PBS containing 1% BSA and incubated for 60 min with primary antibodies diluted in the same buffer (20 µg/ml final concentration). After being rinsed five times in PBS, the slides were incubated for 60 min with FITC-conjugated anti–rabbit IgGs (Zymed Laboratories), diluted at 1:40 in the same buffer, and then rinsed an additional five times in PBS. For nuclear staining, DAPI (0.02 µg/ml final concentration) was added to the secondary antibody solution. Samples were mounted in PermaFluor (Thermo Savant) and micrographs were obtained with an Olympus BX60 fluorescence microscope with a C4742-95 digital color camera (Hamamatsu Photonic System). The images were processed using AquaCosmos (Hamamatsu Photonic System) and Adobe Photoshop.

Immunoelectron Microscopy.
Purified parasites were fixed in 0.1 M phosphate buffer (pH 7.4) containing TAAB (1% paraformaldehyde, 0.1% glutaraldehyde) for 15 min on ice. They were dehydrated in ethanol and embedded in LR gold resin (London Resin Company Ltd.). Ultrathin sections were picked up on 200-mesh nickel grids, blocked for 30 min in PBS containing 0.01% Tween 20 and 5% nonfat dry milk (blocking buffer), incubated at 4°C overnight with primary antibodies diluted in blocking buffer (20 µg/ml final concentration), washed three times with PBS containing 0.01% Tween and 10% Block Ace (Dainippon Laboratories), incubated for 1 h with goat anti–rabbit IgG conjugated to gold particles (15-nm diameter; AuroProbe, Amersham Pharmacia Biotech) diluted at 1:40 in blocking buffer, and washed six times. Finally, the sections were fixed with 2.5% glutaraldehyde for 10 min, rinsed twice in distilled water, and stained with 2% uranyl acetate and Reynold's lead citrate. These samples were examined by a HITACHI H-800 transmission electron microscopy at an accelerating voltage of 100 kV.

Targeted Disruption of the PbMAEBL Gene and Thrombospondin-related Adhesive Protein Gene (TRAP).
The targeting vector for the PbMAEBL gene was constructed as follows. Two partial DNA fragments of the PbMAEBL gene were amplified by PCR using genomic DNA as a template with these primer pairs: 5'-GGCGAGCTCTTATTATTTGCTTCATGTTGTATT-3' and 5'-GCCGGATCCTTTATCCAAGTTCATCGAAAATGT-3'; and 5'-GGCCTCGAGGATGAATATAATGAAGATTTCTTA-3' and 5'-GCCGGTACCAGATGAAAAACATCTACCATTATT-3'. These fragments were subcloned into either side of the selectable marker gene in pBluescript using the unique restriction sites, SacI/BamHI and XhoI/KpnI, respectively. The targeting vector for the PbTRAP gene was constructed in the same manner but using these two primer pairs: 5'-GGCGAGCTCGTACATCTTGTGCTTGAAGC-3' and 5'-GCCGGATCCTGACCATTAAGAAACACAC-3'; and 5'-GGCCTCGAGAAGA-AGTATGTAACGAACAAATCG-3' and 5'-GCCGGTACC-GCAACTTTTTCTACTTCCTGAC-3'. For the gene targeting experiment, the plasmid was completely digested with the restriction enzymes SacI and KpnI to release the linear targeting construct. The gene targeting experiment was performed as previously described (17).

Southern Blot Analysis.
Southern blot analysis was performed as previously described (16). In brief, Pb genomic DNA extracted from blood stage parasites (2 µg) was completely digested with a restriction enzyme, EcoRV or EcoT22i. The fragments were separated on 1.2% agarose gel and transferred to nylon membrane. Partial digestion fragments of PbMAEBL and PbTRAP genes were amplified by PCR using genomic DNA as the template with the primer pairs, 5'-CTAAACAACCATGTAAACATAAAATGG-3' and 5'-ATCCAAGTTCATCGAAAATG-TTTTTCC-3', and 5'-TTATTGGATGGCTCAGGAAGTATT-3' and 5'-CTGGTTCTGCTGGTTCTATAGGTT-3', respectively. The products, labeled with [32P]dCTP, were used as hybridization probes.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
MAEBL Is a Microneme Protein Produced by the Sporozoite in the Oocyst.
In the course of an unpublished expressed sequence tag study of the Pb sporozoites, we found that expressed sequence tags of PbMAEBL transcripts were abundantly included. To confirm MAEBL protein production in this stage, we performed immunofluorescence microscopy, immunoelectron microscopy, and Western blot analysis. Through these experiments we used two distinct antibodies raised against synthetic peptides corresponding to the repetitive region and the cytoplasmic region of PbMAEBL, respectively. In addition, we performed the same experiments in the intraerythrocytic stage parasites because MAEBL was reported to be a merozoite protein (6). In immunofluorescence microscopy, strong staining was observed in the cytoplasm of mature sporozoites collected from the oocyst (midgut) and mainly in the anterior half, which is a typical pattern of microneme staining (Fig. 1 A, left). In contrast, staining was greatly reduced in sporozoites from the salivary gland (Fig. 1 A, middle). Merozoites were not stained by either antibody (Fig. 1 A, right). In immunoelectron microscopy, PbMAEBL was detected in the micronemes of mature sporozoites in the oocyst (Fig. 1 B, left). On the other hand, neither antibody showed any specific affinity against the apical organelles of merozoites, including rhoptories where MAEBL has been reported to be localized (Fig. 1 B, right) (18). By Western blot analysis, PbMAEBL was detected as an ~200-kD protein in oocyst sporozoite preparations but not in the merozoite stage (Fig. 1 C). These results demonstrate that PbMAEBL is a microneme protein specifically produced by sporozoites in the oocyst, which indicates a possibility that PbMAEBL participates in sporozoite infection of the salivary gland.



View larger version (73K):
[in this window]
[in a new window]
 
Figure 1. Stage-specific production of PbMAEBL and localization in the microneme. (A) PbMAEBL is specifically produced by sporozoites in the oocyst. Immunofluorescent staining was performed in sporozoites collected from the midgut (left), sporozoites collected from the salivary glands (middle), and schizonts (right). Parasites were fixed with acetone for 2 min, incubated with polyclonal rabbit antibodies against a synthetic peptide corresponding to the amino acid sequence of the repeat region of PbMAEBL, and then conjugated with FITC with second antibodies. Oocyst sporozoites were stained mainly in the anterior half, which is a typical pattern for microneme staining. The corresponding phase-contrast image or DAPI staining images are shown below. (B) PbMAEBL is localized in micronemes of oocyst sporozoites. Immunoelectron microscopy was performed in the infected mosquito midgut (left) and cultured mature merozoites (right). The midgut was dissected 18 d after an infective blood meal. Merozoites were purified from infected blood after culture for 16 h in vitro. They were fixed and embedded in LR Gold resin. Ultrathin sections were incubated with the same antibodies as used in A and then conjugated with gold particles (15 nm) with second antibodies. Antibodies were attached to the micronemes of oocyst sporozoites but not to the rhoptories (R) and showed no specific affinities to merozoites. D, dense body; bars, 0.5 µm. (C) PbMAEBL was detected as an ~200-kD protein only in the sporozoites. Western blot analysis of PbMAEBL was performed in lysates of sporozoites in the oocysts (Sp) and merozoites (Me). Sporozoites (106) and merozoites (3 x 106) were lysed in the SDS-PAGE sample buffer containing 0.5% SDS, separated on a 8% acrylamide gel, and analyzed by immunoblotting with the same antibodies as in (A). PbMAEBL was detected as a major ~200-kD protein band (closed arrowhead) with a minor band of its putative degraded product (open arrowhead).

 
MAEBL Is Essential for Sporozoite Infection of the Salivary Gland.
To investigate the function of PbMAEBL, we generated PbMAEBL gene-disrupted parasites by homologous recombination (Fig. 2, A and C) (17). Recombinant populations, maebl(-) 1 and 2, were separated from wild-type populations, maebl(+) 1 and 2, by limiting dilution. To exclude the possibility that all of the maebl(-) populations were derived from a single clone, two other maebl(-) populations, maebl(-) 3 and 4, were prepared independently. We also generated PbTRAP gene-disrupted parasite populations, trap(-) 1 and 2, which are known to have no infectivity to either the salivary gland or rat liver cells (Fig. 2, B and C) and used them in the following experiment as controls (15). trap(-) sporozoites are known to lose infectivity due to their loss of gliding motility (15, 19), which is characteristic of invasion by Apicomplexan parasites (20). Therefore, it was expected that the comparison of phenotypes between maebl(-) and trap(-) populations might provide useful information about the function of PbMAEBL. In the intraerythrocytic stage, maebl(-) and maebl(+) populations showed almost equivalent growth rates in rat blood, indicating that PbMAEBL is not required for the normal proliferation of the merozoite. This result is consistent with our observation that PbMAEBL is not produced in the merozoite stage.



View larger version (28K):
[in this window]
[in a new window]
 
Figure 2. Targeted disruption of the PbMAEBL and PbTRAP gene. (A) Schematic representation of the targeted disruption procedure of the PbMAEBL gene. The targeting vector (top) containing a selectable marker gene is integrated into the PbMAEBL gene locus (middle) by double crossover. This recombination event results in the disruption of the PbMAEBL gene locus (bottom) and confers pyrimethamine resistance to PbMAEBL gene-disrupted parasites. The probe used for Southern blot analysis (C, left) is indicated by a solid bar. The recognition sites for EcoRV and the fragment size excised by this restriction enzyme are indicated. (B) Schematic representation of the targeted disruption of the PbTRAP gene. The procedure of TRAP gene disruption is the same as in A. The probe used for Southern blot analysis in C (right) is indicated by a solid bar. The recognition sites for EcoT22i and the fragment size excised by this restriction enzyme are indicated. (C) Southern blot analysis of PbMAEBL (left) and PbTRAP gene-disrupted (right) parasites. DNAs were isolated from the intraerythrocytic stages of respective parasite populations as indicated over each lane. They were digested with the restriction enzyme that is indicated over each panel and hybridized with the probe to the targeted gene that is indicated under each panel. By the integration of the maebl targeting construct, the size of the detected restricted fragments increased from 0.7 to 5.0 kbp (left). By the integration of the trap targeting construct, the size of the detected restricted fragments increased from 1.6 to 1.9 kbp (right). (D) Immunofluorescence microscopy of the wild-type maebl(+) 1 (WT, left) and the PbMAEBL gene-disrupted maebl(-) 1 (KO, right) sporozoite. Sporozoites were collected from mosquito midguts 18 d after an infective blood meal. They were fixed with acetone for 2 min, incubated with polyclonal antibodies against the PbMAEBL repeat region, and then conjugated with FITC with second antibodies. maebl(-) 1 sporozoites were not stained. The same results were obtained in all parasite populations. Arrowheads, the apical end of each sporozoite; x200. (E) Western blot analysis of PbMAEBL in maebl(+) 1 (WT) and maebl(-) 1 (KO) sporozoites. The immunoblot analysis was performed with the same antibodies as used in D. Protein bands in the wild-type parasites disappeared in the knockout parasite.

 
To assess the role of PbMAEBL in the vector-invasive stage, anopheline mosquitoes fed on rats infected with the respective parasite populations. By immunofluorescence microscopy (Fig. 2 D), immunoelectron microscopy (unpublished data), and Western blot analysis (Fig. 2 E), PbMAEBL was not detected in the midgut sporozoites of any maebl(-) population. 20–24 d after an infective blood meal, the number of sporozoites in the midgut, hemocoel (body cavity), and salivary glands were separately counted (Table I). In maebl(-) populations, the number of midgut sporozoites per mosquito was comparable to other populations. However, only a few sporozoites, presumably contaminants from the hemolymph, were associated with the salivary glands. Conversely, the number of hemolymph sporozoites significantly increased, indicating that they were normally released from the oocysts but accumulated in the hemolymph, probably because sporozoite entry into the salivary gland was interrupted at an early stage. When compared with PbTRAP gene-disrupted parasite populations, it is especially noteworthy that the number of salivary gland–associated sporozoites of maebl(-) populations was ~20 times smaller than that of trap(-) populations. Because trap(-) sporozoites have been reported to be associated with the gland surface by trypsin-sensitive binding (15), these results suggest that maebl gene disruption impairs sporozoite ability to attach to the gland surface.


View this table:
[in this window]
[in a new window]
 
Table I. Sporozoite Distributions in Anopheles stephensi Mosquitoes Infected with Wild-type, maebl(-), and trap(-) Populations

 
MAEBL Is Not Involved in Sporozoite Gliding Motility In Vitro.
Impaired motility can reduce sporozoite infectivity to the host cell. To test the possibility that MAEBL gene disruption affects sporozoite motility, the gliding motility of maebl(-) sporozoites was observed in vitro. As shown in Fig. 3 , the hemolymph sporozoite of a maebl(-) population (middle) glided in a normal circle and speed, comparable to that of the maebl(+) wild-type populations (top), and in clear contrast with the PbTRAP gene-disrupted population that completely lost its ability to glide (C) (15). The proportion of the motile sporozoites in maebl(-) populations was also identical to that of the maebl(+) wild-type populations (Table II).



View larger version (53K):
[in this window]
[in a new window]
 
Figure 3. PbMAEBL gene-disrupted parasites, in contrast to PbTRAP-disrupted parasites, showed normal gliding motility in vitro. Sporozoites were collected from the hemolymph of mosquitoes infected with the respective parasite populations 24 d after an infective blood meal. They were kept for 2 h in 3% BSA at 4°C and then gliding on an uncoated microscope slide was observed under a phase-contrast microscope. Time lapse micrographs were recorded at 4-s intervals. x200.

 

View this table:
[in this window]
[in a new window]
 
Table II. Infectivities to Rats and Proportions of Gliding Motility–positive Parasites in Wild-type, maebl(-), and trap(-) Populations

 
MAEBL Does Not Participate in Sporozoite Infection of the Vertebrate Host.
The infectivities of maebl(-) sporozoites to the vertebrate host were investigated using oocyst sporozoites, which are infective to the vertebrate host with a low efficiency (21). In this experiment, infectivities were assessed by the infection rate and the prepatent days required for infected erythrocyte appearance in the rat's blood after intravenous injection. As shown in Table II, the infection rate and prepatent period of the maebl(-) populations were virtually identical to those of the maebl(+) populations. These results show that PbMAEBL is not required for liver cell infection, which is consistent with the observation that the sporozoite greatly reduced its micronemal content of PbMAEBL after salivary gland infection (Fig. 1 A).


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Although MAEBL has been classified as a merozoite protein, our immunological studies did not detect MAEBL in the merozoite. On the other hand, we found that the sporozoite produced this protein abundantly before the invasion of the salivary gland and greatly reduced its content after invasion. Furthermore, our MAEBL gene disruption experiments showed that MAEBL is essential for sporozoite infection of the mosquito salivary glands but not for the merozoite infection of the erythrocyte. These results lead us to conclude that MAEBL is specifically produced by the sporozoite in the oocyst and acts when it infects the mosquito salivary gland.

The immunological detection of MAEBL presence previously reported was performed with an antiserum raised against glutathione-S-transferase–fused MAEBL carboxyl cysteine domain. Noe et al. (18) reported that MAEBL was detected as a 120–140-kD protein in the merozoite by Western blot analysis using this antiserum. However, this size is much smaller than that estimated from the amino acid sequence (~200 kD). On the contrary, our two antibodies of distinct origins detected an ~200-kD protein in the sporozoite stage. The specificity of our antibodies was demonstrated by nonreactivity with MAEBL gene knockout parasites (Fig. 2, D and E). The combined results strongly suggest that the antiserum to glutathione-S-transferase–fused carboxyl cysteine domain used by Noe et al. (18) cross reacted with a distinct protein in the merozoite, which gave the erroneous conclusion that MAEBL is produced by the merozoite.

Immunoelectron microscopic observation showed that MAEBL is localized in the microneme of the sporozoite in the oocyst. The microneme is an apical organelle involved in the invasive motility of the malarial parasite into the host cell and contains adhesive protein-like molecules that belong to protein families conserved among different malarial species or stages, such as the TRAP and DBL families. MAEBL is structurally related to the DBL family, which is a family of merozoite microneme proteins that play a critical role in merozoite commitment to the erythrocyte by forming a tight junction between the merozoite apical surface and the erythrocyte receptors (11, 22). The structural relation to these proteins and its essential role in salivary gland infection suggest that MAEBL may mediate sporozoite migration into the salivary gland by binding to salivary gland receptors.

Both MAEBL and TRAP are microneme proteins of the sporozoite in the oocyst and are involved in its infection of the salivary gland. However, our gene disruption experiment revealed clear phenotypic differences between MAEBL gene knockout sporozoites and TRAP gene knockout sporozoites. TRAP gene knockout sporozoites lost infectivity to both the mosquito salivary gland and the liver cell of the vertebrate host, whereas MAEBL gene knockout sporozoites lost infectivity only to the salivary gland. Furthermore, TRAP gene knockout sporozoites became nonmotile, whereas MAEBL gene knock out sporozoites showed normal gliding motility in vitro. These differences indicate that these molecules play distinct roles in the host cell invasion machinery of the sporozoite. It has been suggested that TRAP is necessary for sporozoite invasion into the host cell, most likely by transmitting motility powered by an actomyosin motor across the parasite plasma membrane (19). On the other hand, normal motility on a glass slide displayed by the MAEBL gene knockout sporozoite suggests that MAEBL is necessary to change the motility observed in vitro into the gliding movement in vivo through direct interactions with the salivary gland. This possibility would be supported by its structural relation to the merozoite adhesive proteins, which interact directly with erythrocyte surface receptors and determine the host specificity of the merozoite.

Another important phenotypic difference observed was the number of sporozoites collected from the salivary glands of infected mosquitoes. As previously reported, some sporozoites are collected from the salivary glands of mosquitoes infected with TRAP gene knockout parasites. In our experiments, ~30–50 sporozoites per mosquito were obtained on average. Sultan et al. (15) reported that such sporozoites were not in the gland lumen but were associated with the gland surface by trypsin-sensitive binding, indicating that TRAP gene knockout sporozoites irreversibly committed to salivary gland invasion by forming a junction with the salivary gland, but their migration was arrested in the following step due to loss of motility. In contrast, the number of sporozoites collected from the salivary glands almost decreased to zero in the MAEBL gene knockout parasite. This suggests that MAEBL gene-disrupted sporozoites become unable to form a junction with the salivary gland and therefore commit to salivary gland invasion. It has been reported that the first step of sporozoite invasion into the salivary gland is migration into the space between the basal lamina of the gland and the basal plasma membrane of the salivary gland cells (3). According to our recent electron micrographic study, sporozoites form a clear, tight junction when they glide into this space (unpublished data). Thus, MAEBL might participate in sporozoite commitment to the salivary gland in this invasion step. Additional investigations including the identification and localization of MAEBL ligands are required to confirm this hypothesis.

In conclusion, we have demonstrated that MAEBL is a microneme protein that is produced by sporozoites in the oocyst and is essential for the sporozoite infection of mosquito salivary glands. We suggest that MAEBL is an attachment protein involved in sporozoite entrance into the salivary gland by binding to specific salivary gland surface receptors and provide the molecular basis to understanding the specific interactions between the malarial parasite and the mosquito salivary gland.


    Acknowledgments
 
This study was supported by a grant in aid for Scientific Research on Priority Areas (08281103) to Y. Chinzei, for Scientific Research (B) (12470060) to M. Yuda, and for Exploratory Research (10877043, 11877043, and 12877042) to Y. Chinzei from the Ministry of Education, Science, Culture, and Sports of Japan. It was also supported by a grant from the Research for the Future Program from the Japan Society for the Promotion of Science to Y. Chinzei.

Submitted: November 12, 2001
Revised: March 11, 2002
Accepted: April 5, 2002


    Footnotes
 
* Abbreviations used in this paper: DBL, Duffy binding-like; Pb, Plasmodium berghei; TRAP, thrombospondin-related adhesive protein. Back


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

1 Warburg, A., and L.H. Miller. 1991. Critical stages in the development of Plasmodium in mosquitoes. Parasitol. Today. 7:179.[CrossRef][Medline]

2 Ghosh, A., M.J. Edwards, and M. Jacobs-Lorena. 2000. The journey of the malaria parasite in the mosquito: hopes for the new century. Parasitol. Today. 16:196–201.[CrossRef][Medline]

3 Pimenta, P.F., M. Touray, and L.H. Miller. 1994. The journey of malaria sporozoites in the mosquito salivary gland. J. Eukaryot. Microbiol. 41:608–624.[Medline]

4 Rosenberg, R. 1985. Inability of Plasmodium knowlesi sporozoites to invade Anopheles freeborni salivary glands. Am. J. Trop. Med. Hyg. 34:687–691.

5 Barreau, C., M. Touray, P.F. Pimenta, L.H. Miller, and K.D. Vernick. 1995. Plasmodium gallinaceum: sporozoite invasion of Aedes aegypti salivary glands is inhibited by anti-gland antibodies and by lectins. Exp. Parasitol. 81:332–343.[CrossRef][Medline]

6 Kappe, S., A.R. Noe, T.S. Fraser, P.L. Blair, and J.H. Adams. 1998. A family of chimeric erythrocyte binding proteins of malaria parasites. Proc. Natl. Acad. Sci. USA. 95:1230–1235.[Abstract/Free Full Text]

7 Adams, J.H., B.K.L. Sim, S.A. Dolan, X. Fang, D.C. Kaslow, and L.H. Miller. 1992. A family of erythrocyte binding proteins of malaria parasites. Proc. Natl. Acad. Sci. USA. 89:7085–7089.[Abstract/Free Full Text]

8 Adams, J.H., P.L. Blair, O. Kaneko, and D.S. Peterson. 2001. An expanding ebl family of Plasmodium falciparum. Trends Parasitol. 17:297–299.[CrossRef][Medline]

9 Adams, J.H., D.E. Hudson, M. Torii, G.E. Ward, T.E. Wellems, M. Aikawa, and L.H. Miller. 1990. The Duffy receptor family of Plasmodium knowlesi is located within the micronemes of invasive malaria merozoites. Cell. 63:141–153.[CrossRef][Medline]

10 Sim, B.K., P.A. Orlandi, J.D. Haynes, F.W. Klotz, J.M. Carter, D. Camus, M.E. Zegans, and J.D. Chulay. 1990. Primary structure of the 175K Plasmodium falciparum erythrocyte binding antigen and identification of a peptide which elicits antibodies that inhibit malaria merozoite invasion. J. Cell Biol. 111:1877–1884.[Abstract/Free Full Text]

11 Miller, L.H., M. Aikawa, J.G. Johnson, and T. Shiroishi. 1979. Interaction between cytochalasin B-treated malarial parasites and erythrocytes. Attachment and junction formation. J. Exp. Med. 149:172–184.[Abstract/Free Full Text]

12 Marshall, V.M., M.G. Peterson, A.M. Lew, and D.J. Kemp. 1989. Structure of the apical membrane antigen I (AMA-1) of Plasmodium chabaudi. Mol. Biochem. Parasitol. 37:281–283.[CrossRef][Medline]

13 Noe, A.R., and J.H. Adams. 1998. Plasmodium yoelii YM MAEBL protein is coexpressed and colocalizes with rhoptry proteins. Mol. Biochem. Parasitol. 96:27–35.[CrossRef][Medline]

14 Kappe, S.H., M.J. Gardner, S.M. Brown, J. Ross, K. Matuschewski, J.M. Ribeiro, J.H. Adams, J. Quackenbush, J. Cho, D.J. Carucci, et al. 2001. Exploring the transcriptome of the malaria sporozoite stage. Proc. Natl. Acad. Sci. USA. 98:9895–9900.[Abstract/Free Full Text]

15 Sultan, A.A., V. Thathy, U. Frevert, K.J. Robson, A. Crisanti, V. Nussenzweig, R.S. Nussenzweig, and R. Menard. 1997. TRAP is necessary for gliding motility and infectivity of Plasmodium sporozoites. Cell. 90:511–522.[CrossRef][Medline]

16 Yuda, M., T. Sawai, and Y. Chinzei. 1999. Structure and expression of an adhesive protein-like molecule of mosquito-invasive stage malarial parasite. J. Exp. Med. 189:1947–1952.[Abstract/Free Full Text]

17 Yuda, M., H. Sakaida, and Y. Chinzei. 1999. Targeted disruption of the Plasmodium berghei CTRP gene reveals its essential role in malaria infection of the vector mosquito. J. Exp. Med. 190:1711–1716.[Abstract/Free Full Text]

18 Noe, A.R., D.J. Fishkind, and J.H. Adams. 2000. Spatial and temporal dynamics of the secretory pathway during differentiation of the Plasmodium yoelii schizont. Mol. Biochem. Parasitol. 108:169–185.[CrossRef][Medline]

19 Kappe, S., T. Bruderer, S. Gantt, H. Fujioka, V. Nussenzweig, and R. Menard. 1999. Conservation of a gliding motility and cell invasion machinery in Apicomplexan parasites. J. Cell Biol. 147:937–944.[Abstract/Free Full Text]

20 Dubremetz, J.F., N. Garcia-Reguet, V. Conseil, and M.N. Fourmaux. 1998. Apical organelles and host-cell invasion by Apicomplexa. Int. J. Parasitol. 28:1007–1013.[CrossRef][Medline]

21 Ball, G.H., and J. Chao. 1961. Infectivity to canaries of sporozoites of Plasmodium relictum developing in vitro. J. Parasitol. 47:787–790.

22 Aikawa, M., L.H. Miller, J. Johnson, and J. Rabbege. 1978. Erythrocyte entry by malarial parasites. A moving junction between erythrocyte and parasite. J. Cell Biol. 77:72–82.[Abstract/Free Full Text]


Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Facebook Facebook   Add to Reddit Reddit   Add to Technorati Technorati   Add to Twitter Twitter    What's this?


This article has been cited by other articles:


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF, 148K)
Right arrow PPT slides of all figures
Right arrow Alert me when this article is cited
Right arrow Citation Map
Services
Right arrow Email this article
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new content in the JEM
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via CrossRef
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kariu, T.
Right arrow Articles by Chinzei, Y.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kariu, T.
Right arrow Articles by Chinzei, Y.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Facebook   Add to Reddit   Add to Technorati   Add to Twitter  
What's this?


  Home | Help | Feedback | Subscriptions | Archive | Search
TABLE OF CONTENTS